Recombinant Human CFB, His-tagged

Cat.No.: CFB-26760TH
Product Overview: Recombinant fragment, corresponding to amino acids 77-764 of Human Factor B with N terminal His tag; MWt 91kDa.
Description: This gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. Polymorphisms in this gene are associated with a reduced risk of age-related macular degeneration. The polyadenylation site of this gene is 421 bp from the 5 end of the gene for complement component 2.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 100 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWP RSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQ TAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCS RGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEV AEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMN IYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPR YGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYED HKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVI ILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLD VYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLE DVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKIS VIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIK VSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQ QQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKG SCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADP NTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKR QKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
Sequence Similarities: Belongs to the peptidase S1 family.Contains 1 peptidase S1 domain.Contains 3 Sushi (CCP/SCR) domains.Contains 1 VWFA domain.
Gene Name: CFB complement factor B [ Homo sapiens ]
Official Symbol: CFB
Synonyms: CFB; complement factor B; B factor, properdin , BF, BFD; H2 Bf;
Gene ID: 629
mRNA Refseq: NM_001710
Protein Refseq: NP_001701
Uniprot ID: P00751
Chromosome Location: 6p21.3
Pathway: Activation of C3 and C5, organism-specific biosystem; Alternative complement activation, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem;
Function: complement binding; peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.