"CFHR2" Related Products

Expand

Recombinant Human CFHR2 protein, GST-tagged

Cat.No.: CFHR2-27137TH
Product Overview: Recombinant Human CFHR2(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 53.46 kDa
AA Sequence: EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKS GYHPTKSHSFRAMCQNGKLVYPSCEEK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CFHR2 complement factor H-related 2 [ Homo sapiens ]
Official Symbol: CFHR2
Synonyms: CFHR2; complement factor H-related 2; CFHL2, H factor (complement) like 3 , HFL3; complement factor H-related protein 2; FHR2; FHR-2; DDESK59; h factor-like 3; factor H-related gene 2; h factor-like protein 2; H factor (complement)-like 3; HFL3; CFHL2;
Gene ID: 3080
mRNA Refseq: NM_005666
Protein Refseq: NP_005657
MIM: 600889
UniProt ID: P36980
Chromosome Location: 1q31.3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.