"CFHR2" Related Products

Expand

Recombinant Human CFHR2 protein, GST-tagged

Cat.No.: CFHR2-27137TH
Product Overview: Recombinant Human CFHR2(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 53.46 kDa
AA Sequence: EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKS GYHPTKSHSFRAMCQNGKLVYPSCEEK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CFHR2 complement factor H-related 2 [ Homo sapiens ]
Official Symbol: CFHR2
Synonyms: CFHR2; complement factor H-related 2; CFHL2, H factor (complement) like 3 , HFL3; complement factor H-related protein 2; FHR2; FHR-2; DDESK59; h factor-like 3; factor H-related gene 2; h factor-like protein 2; H factor (complement)-like 3; HFL3; CFHL2;
Gene ID: 3080
mRNA Refseq: NM_005666
Protein Refseq: NP_005657
MIM: 600889
UniProt ID: P36980
Chromosome Location: 1q31.3

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.