Recombinant Human CFHR2 protein, GST-tagged
Cat.No. : | CFHR2-27137TH |
Product Overview : | Recombinant Human CFHR2(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 19-270 a.a. |
Description : | This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 53.46 kDa |
AA Sequence : | EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKS GYHPTKSHSFRAMCQNGKLVYPSCEEK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CFHR2 complement factor H-related 2 [ Homo sapiens ] |
Official Symbol | CFHR2 |
Synonyms | CFHR2; complement factor H-related 2; CFHL2, H factor (complement) like 3 , HFL3; complement factor H-related protein 2; FHR2; FHR-2; DDESK59; h factor-like 3; factor H-related gene 2; h factor-like protein 2; H factor (complement)-like 3; HFL3; CFHL2; |
Gene ID | 3080 |
mRNA Refseq | NM_005666 |
Protein Refseq | NP_005657 |
MIM | 600889 |
UniProt ID | P36980 |
Chromosome Location | 1q31.3 |
◆ Recombinant Proteins | ||
CFHR2-27137TH | Recombinant Human CFHR2 protein, GST-tagged | +Inquiry |
CFHR2-331H | Recombinant Human CFHR2, His-tagged | +Inquiry |
CFHR2-320H | Recombinant Human CFHR2, His-tagged | +Inquiry |
CFHR2-584H | Recombinant Human CFHR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFHR2-4630H | Recombinant Human CFHR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFHR2-1391HCL | Recombinant Human CFHR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFHR2 Products
Required fields are marked with *
My Review for All CFHR2 Products
Required fields are marked with *
0
Inquiry Basket