Recombinant Human CFL1 CFL1-26778TH

Recombinant Human CFL1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CFL1

Recombinant Human CFL1

CFL1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CFL1-26778TH
Product Overview : Recombinant full length Human Cofilin with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-166; 166 amino acids, MWt 18.5kDa.
Description : The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.
Tissue specificity : Widely distributed in various tissues.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCL SEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDK DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGS AVISLEGKPL
Sequence Similarities : Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain.
Gene Name : CFL1 cofilin 1 (non-muscle) [ Homo sapiens ]
Official Symbol : CFL1
Synonyms : CFL1; cofilin 1 (non-muscle); CFL; cofilin-1;
Gene ID : 1072
mRNA Refseq : NM_005507
Protein Refseq : NP_005498
MIM : 601442
Uniprot ID : P23528
Chromosome Location : 11q13.1
Pathway : Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem;
Function : actin binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy