Recombinant Human CFL1
Cat.No. : | CFL1-26778TH |
Product Overview : | Recombinant full length Human Cofilin with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-166; 166 amino acids, MWt 18.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-166 a.a. |
Description : | The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus. |
Tissue specificity : | Widely distributed in various tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCL SEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDK DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGS AVISLEGKPL |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
Full Length : | Full L. |
Gene Name | CFL1 cofilin 1 (non-muscle) [ Homo sapiens ] |
Official Symbol | CFL1 |
Synonyms | CFL1; cofilin 1 (non-muscle); CFL; cofilin-1; |
Gene ID | 1072 |
mRNA Refseq | NM_005507 |
Protein Refseq | NP_005498 |
MIM | 601442 |
Uniprot ID | P23528 |
Chromosome Location | 11q13.1 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; |
Function | actin binding; protein binding; |
◆ Recombinant Proteins | ||
CFL1-1172H | Recombinant Human CFL1 Protein, GST-Tagged | +Inquiry |
CFL1-2374H | Recombinant Human Cofilin 1 (Non-muscle), GST-tagged | +Inquiry |
CFL1-0152H | Recombinant Human CFL1 Protein (M1-L166), His/Step tagged | +Inquiry |
CFL1-1014R | Recombinant Rat CFL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFL1-1692HFL | Recombinant Full Length Human CFL1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFL1-7555HCL | Recombinant Human CFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL1 Products
Required fields are marked with *
My Review for All CFL1 Products
Required fields are marked with *