Recombinant Human CFLAR

• Cat.No.: CFLAR-28415TH
• Product Overview: Recombinant full length Human FLIP ; 480aa, 55.3kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 480 amino acids
• Description: The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists.
• Molecular Weight: 55.300kDa
• Tissue specificity: Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLENSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
• Sequence Similarities: Belongs to the peptidase C14A family.Contains 2 DED (death effector) domains.

Gene Information

• Gene Name: CFLAR CASP8 and FADD-like apoptosis regulator [ Homo sapiens ]
• Official Symbol: CFLAR
• Synonyms: CFLAR; CASP8 and FADD-like apoptosis regulator; CASP8AP1; c FLIP; CASH; Casper; CLARP; FLAME; FLIP; I FLICE; MRIT
• Gene ID: 8837
• mRNA Refseq: NM_001127183
• Protein Refseq: NP_001120655
• MIM: 603599
• Uniprot ID: O15519
• Chromosome Location: 2q33-q34
• Pathway: Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem
• Function: cysteine-type endopeptidase activity; protein binding