Recombinant Human CFLAR Protein, GST-Tagged

Cat.No. : CFLAR-1176H
Product Overview : Human CFLAR full-length ORF (AAH01602.1, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011]
Molecular Mass : 78.43 kDa
AA Sequence : MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CFLAR CASP8 and FADD-like apoptosis regulator [ Homo sapiens ]
Official Symbol CFLAR
Synonyms CFLAR; CASP8 and FADD-like apoptosis regulator; CASP8AP1; c FLIP; CASH; Casper; CLARP; FLAME; FLIP; I FLICE; MRIT; usurpin beta; caspase homolog; inhibitor of FLICE; caspase-eight-related protein; MACH-related inducer of toxicity; FADD-like anti-apoptotic molecule; FADD-like antiapoptotic molecule 1; caspase-related inducer of apoptosis; cellular FLICE-like inhibitory protein; caspase-like apoptosis regulatory protein; FLAME1; c-FLIP; FLAME-1; I-FLICE; c-FLIPL; c-FLIPR; c-FLIPS;
Gene ID 8837
mRNA Refseq NM_001127183
Protein Refseq NP_001120655
MIM 603599
UniProt ID O15519

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFLAR Products

Required fields are marked with *

My Review for All CFLAR Products

Required fields are marked with *

0
cart-icon
0
compare icon