Recombinant Human CHD1

• Cat.No.: CHD1-27812TH
• Product Overview: Recombinant fragment of Human CHD1 with N-terminal proprietary tag. Predicted MW 36.19 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 96 amino acids
• Description: The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains.CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.
• Molecular Weight: 36.190kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
• Sequence Similarities: Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.

Gene Information

• Gene Name: CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ]
• Official Symbol: CHD1
• Synonyms: CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1
• Gene ID: 1105
• mRNA Refseq: NM_001270
• Protein Refseq: NP_001261
• MIM: 602118
• Uniprot ID: O14646
• Chromosome Location: 5q15-q21
• Function: ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity