Recombinant Human CHD1
| Cat.No. : | CHD1-27812TH |
| Product Overview : | Recombinant fragment of Human CHD1 with N-terminal proprietary tag. Predicted MW 36.19 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 96 amino acids |
| Description : | The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains.CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. |
| Molecular Weight : | 36.190kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
| Sequence Similarities : | Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
| Gene Name | CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ] |
| Official Symbol | CHD1 |
| Synonyms | CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1; |
| Gene ID | 1105 |
| mRNA Refseq | NM_001270 |
| Protein Refseq | NP_001261 |
| MIM | 602118 |
| Uniprot ID | O14646 |
| Chromosome Location | 5q15-q21 |
| Function | ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity; |
| ◆ Recombinant Proteins | ||
| CHD1-27812TH | Recombinant Human CHD1 | +Inquiry |
| CHD1-6501C | Recombinant Chicken CHD1 | +Inquiry |
| CHD1-03H | Recombinant Human CHD1 Protein (268-452), N-His tagged | +Inquiry |
| CHD1-3376M | Recombinant Mouse CHD1 Protein | +Inquiry |
| CHD1-6842Z | Recombinant Zebrafish CHD1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD1 Products
Required fields are marked with *
My Review for All CHD1 Products
Required fields are marked with *




