Recombinant Human CHD1

Cat.No. : CHD1-27812TH
Product Overview : Recombinant fragment of Human CHD1 with N-terminal proprietary tag. Predicted MW 36.19 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 96 amino acids
Description : The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains.CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.
Molecular Weight : 36.190kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS
Sequence Similarities : Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name CHD1 chromodomain helicase DNA binding protein 1 [ Homo sapiens ]
Official Symbol CHD1
Synonyms CHD1; chromodomain helicase DNA binding protein 1; chromodomain-helicase-DNA-binding protein 1;
Gene ID 1105
mRNA Refseq NM_001270
Protein Refseq NP_001261
MIM 602118
Uniprot ID O14646
Chromosome Location 5q15-q21
Function ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD1 Products

Required fields are marked with *

My Review for All CHD1 Products

Required fields are marked with *

0
cart-icon