"CHD2" Related Products

Expand
Expand

Recombinant Human CHD2

Cat.No.: CHD2-27813TH
Product Overview: Recombinant full length Human CHD2 with an N terminal proprietary tag; Predicted MWt 81.22 kDa.
Description: The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein length: 501 amino acids
Molecular Weight: 81.220kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESE QGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLP EAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPS RFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQ EQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRG KRKKQDSSDEDDDDDEAPKRQTRRRAAKNVSYKEDDDFET DSDDLIEMTGEGVDEQQDNSETIEKVLDSRLGKKGATGAS TTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHST WESEESLQQQKVKGLKKLENFKKKEDEIKQWLGKVSPEDV EYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPA HSRKPAPSNEPEYLCKWMGLPYSECSWEDEALIGKKFQNC IDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGE NLELRDYQLEGLNWLAHSWCK
Sequence Similarities: Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name: CHD2 chromodomain helicase DNA binding protein 2 [ Homo sapiens ]
Official Symbol: CHD2
Synonyms: CHD2; chromodomain helicase DNA binding protein 2; chromodomain-helicase-DNA-binding protein 2; DKFZp547I1315; DKFZp686E01200; DKFZp781D1727; FLJ38614;
Gene ID: 1106
mRNA Refseq: NM_001042572
Protein Refseq: NP_001036037
MIM: 602119
Uniprot ID: O14647
Chromosome Location: 15q26
Function: ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.