"CHKA" Related Products

Expand
Expand
Expand

Recombinant Human CHKA

Cat.No.: CHKA-26903TH
Product Overview: Recombinant full length Human Choline kinase alpha protein with an N terminal proprietary tag; predicted mwt: 76.34 kDa inclusive of tag.
Description: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 457 amino acids
Molecular Weight: 76.340kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAA SDLESKQLGGQQPPLALPPPPPLPLPLPLPQPPPPQPPAD EQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGL SNMLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKE GSEQAQKENEFQGAEAMVLESVMFAILAERSLGPKLYGIF PQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKM PFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSY NLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLEGREN SEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYP FFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSI IKEEMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMDY AQARFDAYFHQKRKLGV
Gene Name: CHKA choline kinase alpha [ Homo sapiens ]
Official Symbol: CHKA
Synonyms: CHKA; choline kinase alpha; CHK, choline kinase; CKI;
Gene ID: 1119
mRNA Refseq: NM_001277
Protein Refseq: NP_001268
MIM: 118491
Uniprot ID: P35790
Chromosome Location: 11q13.1
Pathway: Acetylcholine Synthesis, organism-specific biosystem; Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Phosphatidylcholine (PC) biosynthesis, choline =>
Function: ATP binding; choline binding; choline kinase activity; drug binding; ethanolamine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.