"CHMP6" Related Products

Expand

Recombinant Human CHMP6, His-tagged

Cat.No.: CHMP6-27071TH
Product Overview: Recombinant fragment, corresponding to amino acids 59-201 of Human CHMP6 with an N-terminal His Tag, approximately 28kDa
Description: CHMP6 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEM KVMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEY QRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAAS
Gene Name: CHMP6 charged multivesicular body protein 6 [ Homo sapiens ]
Official Symbol: CHMP6
Synonyms: CHMP6; charged multivesicular body protein 6; chromatin modifying protein 6; FLJ11749; VPS20;
Gene ID: 79643
mRNA Refseq: NM_024591
Protein Refseq: NP_078867
MIM: 610901
Uniprot ID: Q96FZ7
Chromosome Location: 17q25.3
Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function: protein N-terminus binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.