Recombinant Human CHMP6, His-tagged

• Cat.No.: CHMP6-27071TH
• Product Overview: Recombinant fragment, corresponding to amino acids 59-201 of Human CHMP6 with an N-terminal His Tag, approximately 28kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 59-201 a.a.
• Description: CHMP6 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
• Conjugation: HIS
• Form: Lyophilised:reconstitution with 88 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEM KVMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEY QRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAAS

Gene Information

• Gene Name: CHMP6 charged multivesicular body protein 6 [ Homo sapiens ]
• Official Symbol: CHMP6
• Synonyms: CHMP6; charged multivesicular body protein 6; chromatin modifying protein 6; FLJ11749; VPS20
• Gene ID: 79643
• mRNA Refseq: NM_024591
• Protein Refseq: NP_078867
• MIM: 610901
• Uniprot ID: Q96FZ7
• Chromosome Location: 17q25.3
• Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
• Function: protein N-terminus binding