Recombinant Human CHMP6, His-tagged

Cat.No. : CHMP6-27071TH
Product Overview : Recombinant fragment, corresponding to amino acids 59-201 of Human CHMP6 with an N-terminal His Tag, approximately 28kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 59-201 a.a.
Description : CHMP6 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
Conjugation : HIS
Form : Lyophilised:reconstitution with 88 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEM KVMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEY QRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPEKIPENVPVKARPRQAELVAAS
Gene Name CHMP6 charged multivesicular body protein 6 [ Homo sapiens ]
Official Symbol CHMP6
Synonyms CHMP6; charged multivesicular body protein 6; chromatin modifying protein 6; FLJ11749; VPS20;
Gene ID 79643
mRNA Refseq NM_024591
Protein Refseq NP_078867
MIM 610901
Uniprot ID Q96FZ7
Chromosome Location 17q25.3
Pathway ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function protein N-terminus binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHMP6 Products

Required fields are marked with *

My Review for All CHMP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon