Recombinant Human CIDEC

Cat.No. : CIDEC-27245TH
Product Overview : Recombinant full length Human CIDE C with proprietary tag; Predicted MWt 52.29 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 238 amino acids
Description : This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene.
Molecular Weight : 52.290kDa inclusive of tags
Tissue specificity : Expressed mainly in small intestine, heart, colon and stomach and, at lower levels, in brain, kidney and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
Sequence Similarities : Contains 1 CIDE-N domain.
Gene Name CIDEC cell death-inducing DFFA-like effector c [ Homo sapiens ]
Official Symbol CIDEC
Synonyms CIDEC; cell death-inducing DFFA-like effector c; cell death activator CIDE-3; CIDE 3; FLJ20871; Fsp27;
Gene ID 63924
mRNA Refseq NM_001199551
Protein Refseq NP_001186480
MIM 612120
Uniprot ID Q96AQ7
Chromosome Location 3p25
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CIDEC Products

Required fields are marked with *

My Review for All CIDEC Products

Required fields are marked with *

0
cart-icon
0
compare icon