"CIRBP" Related Products

Expand
Expand
Expand

Recombinant Human CIRBP, His-tagged

Cat.No.: CIRBP-27194TH
Product Overview: Recombinant full length protein, (amino acids 1-172) of Human CIRBP with N terminal His tag; 192 amino acids, 20.8 kDa.
Description: Cold-inducible RNA-binding protein is a protein that in humans is encoded by the CIRBP gene.
Protein length: 172 amino acids
Conjugation: HIS
Molecular Weight: 20.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 0.58% Sodium chloride
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASDEGKLFVGGLSFDTNEQ SLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA KDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGG RGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Sequence Similarities: Contains 1 RRM (RNA recognition motif) domain.
Gene Name: CIRBP cold inducible RNA binding protein [ Homo sapiens ]
Official Symbol: CIRBP
Synonyms: CIRBP; cold inducible RNA binding protein; cold-inducible RNA-binding protein; CIRP; Cold inducible RNA binding protein; glycine rich RNA binding protein;
Gene ID: 1153
mRNA Refseq: NM_001280
Protein Refseq: NP_001271
MIM: 602649
Uniprot ID: Q14011
Chromosome Location: 19p13.3
Function: RNA binding; SSU rRNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.