Recombinant Human CKAP4 protein, His-tagged
| Cat.No. : | CKAP4-28002TH |
| Product Overview : | Recombinant Human CKAP4 protein(254-602 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 254-602 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CKAP4 cytoskeleton-associated protein 4 [ Homo sapiens ] |
| Official Symbol | CKAP4 |
| Synonyms | CKAP4; cytoskeleton-associated protein 4; CLIMP 63; ERGIC 63; P63; 63 kDa membrane protein; type-II transmembrane protein p63; 63-kDa cytoskeleton-linking membrane protein; transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediate compartment; p63; CLIMP-63; ERGIC-63; MGC99554; |
| Gene ID | 10970 |
| mRNA Refseq | NM_006825 |
| Protein Refseq | NP_006816 |
| UniProt ID | Q07065 |
| ◆ Recombinant Proteins | ||
| CKAP4-001H | Recombinant Human CKAP4 protein, His-tagged | +Inquiry |
| CKAP4-2831H | Recombinant Human CKAP4 protein(141-460 aa), C-His-tagged | +Inquiry |
| CKAP4-3492M | Recombinant Mouse CKAP4 Protein | +Inquiry |
| CKAP4-2819M | Recombinant Mouse CKAP4 Protein (109-575 aa), His-MBP-tagged | +Inquiry |
| CKAP4-1705M | Recombinant Mouse CKAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKAP4 Products
Required fields are marked with *
My Review for All CKAP4 Products
Required fields are marked with *
