Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human CLK1

Cat.No. : CLK1-27274TH
Product Overview : Recombinant full length Human CLK1 with N terminal proprietary tag, predicted mwt: 79.31 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 484 amino acids
Molecular Weight : 79.310kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQE NKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDY TQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSAR YEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYC EAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPD IKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPK HMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFM LSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL KKSI
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.Contains 1 protein kinase domain.
Gene Name : CLK1 CDC-like kinase 1 [ Homo sapiens ]
Official Symbol : CLK1
Synonyms : CLK1; CDC-like kinase 1; dual specificity protein kinase CLK1;
Gene ID : 1195
mRNA Refseq : NM_001162407
Protein Refseq : NP_001155879
MIM : 601951
Uniprot ID : P49759
Chromosome Location : 2q33
Pathway : Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; mRNA processing, organism-specific biosystem;
Function : ATP binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein serine/threonine kinase activity; protein serine/threonine/tyrosine kinase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How is CLK1 expression regulated in normal physiological conditions? 10/18/2020

CLK1 expression is tightly regulated at transcriptional and post-translational levels, ensuring its proper function in normal cellular processes.

How is CLK1 activity measured in research settings? 06/09/2020

Researchers often measure CLK1 activity through in vitro kinase assays or by monitoring its phosphorylation targets in cellular or tissue samples.

Can targeting CLK1 have implications for neurodegenerative diseases? 06/09/2018

Yes, studies suggest that CLK1 inhibitors may have therapeutic potential for neurodegenerative disorders by modulating RNA splicing.

Are there any known CLK1 mutations associated with diseases? 09/16/2017

Some studies suggest that CLK1 mutations may be associated with certain diseases, but further research is needed to establish clear links.

Are there any CLK1 inhibitors under development for cancer treatment? 01/21/2016

Yes, several CLK1 inhibitors are in preclinical and clinical development as potential anticancer agents.

Customer Reviews (3)

Write a review
Reviews
01/31/2021

    The manufacturer's commitment to customer satisfaction extends beyond technical support. They offer a comprehensive range of related products and resources to aid researchers in their trials.

    01/22/2019

      From troubleshooting to optimizing experimental protocols, the manufacturer provides diligent support to ensure the success of the trial.

      09/28/2018

        The CLK1 protein offers several advantageous features that make it an ideal choice for researchers conducting trials.

        Ask a Question for All CLK1 Products

        Required fields are marked with *

        My Review for All CLK1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends