"CLK1" Related Products

Expand
Expand

Recombinant Human CLK1

Cat.No.: CLK1-27274TH
Product Overview: Recombinant full length Human CLK1 with N terminal proprietary tag, predicted mwt: 79.31 kDa.
Description: This gene encodes a member of the CDC2-like (or LAMMER) family of dual specificity protein kinases. In the nucleus, the encoded protein phosphorylates serine/arginine-rich proteins involved in pre-mRNA processing, releasing them into the nucleoplasm. The choice of splice sites during pre-mRNA processing may be regulated by the concentration of transacting factors, including serine/arginine rich proteins. Therefore, the encoded protein may play an indirect role in governing splice site selection. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 484 amino acids
Molecular Weight: 79.310kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQE NKRCKYNHSKMCDSHYLESRSINEKDYHSRRYIDEYRNDY TQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSAR YEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYC EAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLH SNKLTHTDLKPENILFVQSDYTEAYNPKIKRDERTLINPD IKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPK HMIQKTRKRKYFHHDRLDWDEHSSAGRYVSRRCKPLKEFM LSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL KKSI
Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. Lammer subfamily.Contains 1 protein kinase domain.
Gene Name: CLK1 CDC-like kinase 1 [ Homo sapiens ]
Official Symbol: CLK1
Synonyms: CLK1; CDC-like kinase 1; dual specificity protein kinase CLK1;
Gene ID: 1195
mRNA Refseq: NM_001162407
Protein Refseq: NP_001155879
MIM: 601951
Uniprot ID: P49759
Chromosome Location: 2q33
Pathway: Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; mRNA processing, organism-specific biosystem;
Function: ATP binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein serine/threonine kinase activity; protein serine/threonine/tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.