"CLTC" Related Products

Expand

Recombinant Human CLTC, GST-tagged

Cat.No.: CLTC-26707TH
Product Overview: Human CLTC partial ORF (NP_004850, 232 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
Description: Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Molecular Mass: 37.73 kDa
AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Applications: AP; Array; ELISA; WB-Re
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: Clathrin heavy chain [ Homo sapiens (human) ]
Official Symbol: CLTC
Synonyms: CHC; CHC17; CLH-17; CLTCL2; Hc; KIAA0034
Gene ID: 1213
mRNA Refseq: NM_004859
Protein Refseq: NP_004850
MIM: 118955
UniProt ID: Q00610
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.