Recombinant Human CLTC, GST-tagged

Cat.No. : CLTC-26707TH
Product Overview : Human CLTC partial ORF (NP_004850, 232 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Molecular Mass : 37.73 kDa
AA Sequence : EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Applications : AP; Array; ELISA; WB-Re
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name Clathrin heavy chain [ Homo sapiens (human) ]
Official Symbol CLTC
Synonyms CHC; CHC17; CLH-17; CLTCL2; Hc; KIAA0034
Gene ID 1213
mRNA Refseq NM_004859
Protein Refseq NP_004850
MIM 118955
UniProt ID Q00610

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLTC Products

Required fields are marked with *

My Review for All CLTC Products

Required fields are marked with *

0
cart-icon