Recombinant Human CLTC, GST-tagged

• Cat.No.: CLTC-26707TH
• Product Overview: Human CLTC partial ORF (NP_004850, 232 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
• Molecular Mass: 37.73 kDa
• AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
• Applications: AP; Array; ELISA; WB-Re
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: Clathrin heavy chain [ Homo sapiens (human) ]
• Official Symbol: CLTC
• Synonyms: CHC; CHC17; CLH-17; CLTCL2; Hc; KIAA0034
• Gene ID: 1213
• mRNA Refseq: NM_004859
• Protein Refseq: NP_004850
• MIM: 118955
• UniProt ID: Q00610