"CNN2" Related Products

Expand
Expand

Recombinant Human CNN2

Cat.No.: CNN2-28010TH
Product Overview: Recombinant fragment of Human CNN2 (amino acids 193-290) with a N terminal proprietary tag; Predicted MWt 36.41 kDa including the tag.
Description: The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Heart and smooth muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDC
Sequence Similarities: Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain.
Gene Name: CNN2 calponin 2 [ Homo sapiens ]
Official Symbol: CNN2
Synonyms: CNN2; calponin 2; calponin-2;
Gene ID: 1265
mRNA Refseq: NM_004368
Protein Refseq: NP_004359
MIM: 602373
Uniprot ID: Q99439
Chromosome Location: 19p13.3
Pathway: Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function: actin binding; calmodulin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.