Recombinant Full Length Human CNN2 Protein, GST-tagged
| Cat.No. : | CNN2-1929HF | 
| Product Overview : | Human CNN2 full-length ORF (1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 309 amino acids | 
| Description : | The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015] | 
| Molecular Mass : | 60.1 kDa | 
| AA Sequence : | MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CNN2 calponin 2 [ Homo sapiens ] | 
| Official Symbol | CNN2 | 
| Synonyms | CNN2; calponin 2; calponin-2; neutral calponin; calponin H2, smooth muscle | 
| Gene ID | 1265 | 
| mRNA Refseq | NM_004368 | 
| Protein Refseq | NP_004359 | 
| MIM | 602373 | 
| UniProt ID | Q99439 | 
| ◆ Recombinant Proteins | ||
| CNN2-12529Z | Recombinant Zebrafish CNN2 | +Inquiry | 
| CNN2-1806M | Recombinant Mouse CNN2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CNN2-3796H | Recombinant Human CNN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CNN2-5083H | Recombinant Human CNN2, His-tagged | +Inquiry | 
| CNN2-1929HF | Recombinant Full Length Human CNN2 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CNN2-7405HCL | Recombinant Human CNN2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN2 Products
Required fields are marked with *
My Review for All CNN2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            