"CNR1" Related Products

Expand
Expand

Recombinant Human CNR1

Cat.No.: CNR1-27264TH
Product Overview: Recombinant fragment corresponding to amino acids 1-110 of Human Cannabinoid Receptor I with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag.
Description: This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASK LGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE FYNKSLSSFKENEENIQCGENFMDIECFMV
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: CNR1 cannabinoid receptor 1 (brain) [ Homo sapiens ]
Official Symbol: CNR1
Synonyms: CNR1; cannabinoid receptor 1 (brain); CNR; cannabinoid receptor 1; CANN6; CB R; CB1; CB1A; CB1K5;
Gene ID: 1268
mRNA Refseq: NM_001160226
Protein Refseq: NP_001153698
MIM: 114610
Uniprot ID: P21554
Chromosome Location: 6q14-q15
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function: cannabinoid receptor activity; drug binding; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.