Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CNR1

Cat.No. : CNR1-27264TH
Product Overview : Recombinant fragment corresponding to amino acids 1-110 of Human Cannabinoid Receptor I with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASK LGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE FYNKSLSSFKENEENIQCGENFMDIECFMV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name : CNR1 cannabinoid receptor 1 (brain) [ Homo sapiens ]
Official Symbol : CNR1
Synonyms : CNR1; cannabinoid receptor 1 (brain); CNR; cannabinoid receptor 1; CANN6; CB R; CB1; CB1A; CB1K5;
Gene ID : 1268
mRNA Refseq : NM_001160226
Protein Refseq : NP_001153698
MIM : 114610
Uniprot ID : P21554
Chromosome Location : 6q14-q15
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function : cannabinoid receptor activity; drug binding; receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
What are the mechanisms of action of CNR1 receptor agonists and antagonists? 07/17/2022

The protein receptor agonists can bind to receptors, activate receptors, and promote their signal transduction, resulting in physiological effects. CNR1 receptor antagonists, on the other hand, can bind to the receptor and prevent endocannabinoids from binding to the receptor, thereby inhibiting its signal transduction.

What are the types of CNR1 mutations? 06/10/2021

There are many types of mutations in the CNR1 gene, including single nucleotide substitution, insertion, or deletion. These mutations may cause structural and functional changes in the CNR1 receptor, affecting its binding and signal transduction to endocannabinoids.

What role does the CNR1 receptor play in neuronal connections and neural circuits? 03/10/2021

CNR1 receptors play an important role in neuronal connections and neural circuits. It is involved in the growth, differentiation, and synapse formation of neurons, as well as in the regulation of neural circuits and signal transduction.

How about the potential applications of the CNR1 receptor in drug development? 08/22/2020

CNR1 receptors have potential applications in drug development. Some studies have shown that CNR1 receptor agonists or antagonists can be used to treat neurological disorders such as pain, depression, and anxiety.

Does the CNR1 gene polymorphism affect individual differences? 08/11/2020

Polymorphisms in the CNR1 gene may cause differences in individual responses to medications. Some polymorphisms may increase an individual's sensitivity or tolerance to medications, which can affect the efficacy and safety of medications.

Do environmental factors influence CNR1 gene expression? 12/01/2019

For example, some drugs, toxins, or stressors may affect the expression level of the CNR1 gene, thus affecting its function and signal transduction processes.

Customer Reviews (3)

Write a review
Reviews
08/18/2022

    DNA binding ability is strong, and it performs well in related experiments.

    04/24/2022

      The immunogenicity is very weak, does not cause an immune response, and has a high safety profile.

      04/09/2022

        CNR1 has a long shelf life and good stability, which is convenient for the continuity of subsequent experiments.

        Ask a Question for All CNR1 Products

        Required fields are marked with *

        My Review for All CNR1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends