Recombinant Human CNR1
Cat.No. : | CNR1-27264TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-110 of Human Cannabinoid Receptor I with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASK LGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE FYNKSLSSFKENEENIQCGENFMDIECFMV |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | CNR1 cannabinoid receptor 1 (brain) [ Homo sapiens ] |
Official Symbol : | CNR1 |
Synonyms : | CNR1; cannabinoid receptor 1 (brain); CNR; cannabinoid receptor 1; CANN6; CB R; CB1; CB1A; CB1K5; |
Gene ID : | 1268 |
mRNA Refseq : | NM_001160226 |
Protein Refseq : | NP_001153698 |
MIM : | 114610 |
Uniprot ID : | P21554 |
Chromosome Location : | 6q14-q15 |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function : | cannabinoid receptor activity; drug binding; receptor activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
CNR1-1597H | Recombinant Human CNR1 Protein, GST-tagged | +Inquiry |
CNR1-1498R | Recombinant Rat Cnr1 Protein | +Inquiry |
CNR1-2711H | Recombinant Human CNR1 Protein, His-tagged | +Inquiry |
CNR1-772R | Recombinant Rhesus Macaque CNR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR1-947R | Recombinant Rhesus monkey CNR1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CNR1-7395HCL | Recombinant Human CNR1 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1180 | CNR1 CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1179 | cAMP CNR1 (CB1) CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionThe protein receptor agonists can bind to receptors, activate receptors, and promote their signal transduction, resulting in physiological effects. CNR1 receptor antagonists, on the other hand, can bind to the receptor and prevent endocannabinoids from binding to the receptor, thereby inhibiting its signal transduction.
There are many types of mutations in the CNR1 gene, including single nucleotide substitution, insertion, or deletion. These mutations may cause structural and functional changes in the CNR1 receptor, affecting its binding and signal transduction to endocannabinoids.
CNR1 receptors play an important role in neuronal connections and neural circuits. It is involved in the growth, differentiation, and synapse formation of neurons, as well as in the regulation of neural circuits and signal transduction.
CNR1 receptors have potential applications in drug development. Some studies have shown that CNR1 receptor agonists or antagonists can be used to treat neurological disorders such as pain, depression, and anxiety.
Polymorphisms in the CNR1 gene may cause differences in individual responses to medications. Some polymorphisms may increase an individual's sensitivity or tolerance to medications, which can affect the efficacy and safety of medications.
For example, some drugs, toxins, or stressors may affect the expression level of the CNR1 gene, thus affecting its function and signal transduction processes.
Customer Reviews (3)
Write a reviewDNA binding ability is strong, and it performs well in related experiments.
The immunogenicity is very weak, does not cause an immune response, and has a high safety profile.
CNR1 has a long shelf life and good stability, which is convenient for the continuity of subsequent experiments.
Ask a Question for All CNR1 Products
Required fields are marked with *
My Review for All CNR1 Products
Required fields are marked with *
Inquiry Basket