| Species : |
Rat |
| Source : |
E.coli |
| Description : |
Enables cannabinoid receptor activity. Involved in several processes, including positive regulation of acute inflammatory response; regulation of secretion by cell; and response to alkaloid. Located in membrane raft and plasma membrane. Colocalizes with intracellular membrane-bounded organelle. Used to study several diseases, including Parkinsonism; diabetic neuropathy; impotence; obesity; and peptic ulcer disease. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in obesity; schizophrenia; and type 2 diabetes mellitus. Orthologous to human CNR1 (cannabinoid receptor 1). |
| Molecular Mass : |
58.9 kDa |
| AA Sequence : |
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
| Purity : |
≥ 90% by SDS-PAGE |
| Storage : |
Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : |
Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% DDM, 6% Trehalose, pH 8.0.
The volume before lyophilization is 100 μL/vial. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
