Recombinant Rat Cnr1 Protein

Cat.No. : CNR1-1498R
Product Overview : Recombinant Rat CNR1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Enables cannabinoid receptor activity. Involved in several processes, including positive regulation of acute inflammatory response; regulation of secretion by cell; and response to alkaloid. Located in membrane raft and plasma membrane. Colocalizes with intracellular membrane-bounded organelle. Used to study several diseases, including Parkinsonism; diabetic neuropathy; impotence; obesity; and peptic ulcer disease. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in obesity; schizophrenia; and type 2 diabetes mellitus. Orthologous to human CNR1 (cannabinoid receptor 1).
Molecular Mass : 58.9 kDa
AA Sequence : MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Purity : ≥ 90% by SDS-PAGE
Storage : Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Lyophilized from 20 mM Tris-HCl, 0.15 M NaCl, 0.05% DDM, 6% Trehalose, pH 8.0.
The volume before lyophilization is 100 μL/vial.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Cnr1 cannabinoid receptor 1 [ Rattus norvegicus (Norway rat) ]
Official Symbol Cnr1
Synonyms Cnr1; cannabinoid receptor 1; SKR6R; cannabinoid receptor 1; CB-R; CB1; brain-type cannabinoid receptor; cannabinoid receptor 1 (brain)
Gene ID 25248
mRNA Refseq NM_012784
Protein Refseq NP_036916
UniProt ID P20272

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cnr1 Products

Required fields are marked with *

My Review for All Cnr1 Products

Required fields are marked with *

0
cart-icon