Recombinant Human CNR2

Cat.No. : CNR2-26236TH
Product Overview : Recombinant full length Human Cannabinoid Receptor II with N terminal proprietary tag; Predicted MWt 65.67 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 360 amino acids
Description : The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Molecular Weight : 65.670kDa inclusive of tags
Tissue specificity : Preferentially expressed in cells of the immune system with higher expression in B cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLC TLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAG ADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFT ASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGI MWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGM ARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLS DQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHH CLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDS RDLDLSDC
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ]
Official Symbol CNR2
Synonyms CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2;
Gene ID 1269
mRNA Refseq NM_001841
Protein Refseq NP_001832
MIM 605051
Uniprot ID P34972
Chromosome Location 1p
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function cannabinoid receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNR2 Products

Required fields are marked with *

My Review for All CNR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon