"CNR2" Related Products

Expand
Expand

Recombinant Human CNR2

Cat.No.: CNR2-26236TH
Product Overview: Recombinant full length Human Cannabinoid Receptor II with N terminal proprietary tag; Predicted MWt 65.67 kDa inclusive of tag.
Description: The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors.
Protein length: 360 amino acids
Molecular Weight: 65.670kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Preferentially expressed in cells of the immune system with higher expression in B cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLC TLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAG ADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFT ASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGI MWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGM ARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLS DQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHH CLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDS RDLDLSDC
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ]
Official Symbol: CNR2
Synonyms: CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2;
Gene ID: 1269
mRNA Refseq: NM_001841
Protein Refseq: NP_001832
MIM: 605051
Uniprot ID: P34972
Chromosome Location: 1p
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function: cannabinoid receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.