Recombinant Full Length Human CNR2 Protein
Cat.No. : | CNR2-102HF |
Product Overview : | Recombinant full length Human Cannabinoid Receptor II with N terminal proprietary tag; Predicted MWt 65.67 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 360 amino acids |
Description : | The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Form : | Liquid |
Molecular Mass : | 65.670kDa inclusive of tags |
AA Sequence : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLC TLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAG ADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFT ASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGI MWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGM ARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLS DQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHH CLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDS RDLDLSDC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ] |
Official Symbol | CNR2 |
Synonyms | CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2 |
Gene ID | 1269 |
mRNA Refseq | NM_001841 |
Protein Refseq | NP_001832 |
MIM | 605051 |
UniProt ID | P34972 |
◆ Recombinant Proteins | ||
RFL18885RF | Recombinant Full Length Rat Cannabinoid Receptor 2(Cnr2) Protein, His-Tagged | +Inquiry |
CNR2-102HF | Recombinant Full Length Human CNR2 Protein | +Inquiry |
CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
RFL32311MF | Recombinant Full Length Mouse Cannabinoid Receptor 2(Cnr2) Protein, His-Tagged | +Inquiry |
Cnr2-29R | Recombinant Rat Cnr2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR2 Products
Required fields are marked with *
My Review for All CNR2 Products
Required fields are marked with *
0
Inquiry Basket