Recombinant Full Length Human CNR2 Protein, N-GST-tagged
Cat.No. : | CNR2-13HFL |
Product Overview : | Human CNR2 full-length ORF ( NP_001832.1, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 360 a.a |
Description : | The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 66.1 kDa |
AA Sequence : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC |
Purity : | Glutathione Sepharose 4 Fast Flow |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Preparation : | in vitro wheat germ expression system |
Gene Name | CNR2 cannabinoid receptor 2 [ Homo sapiens (human) ] |
Official Symbol | CNR2 |
Synonyms | CB2; CX5; CB-2 |
Gene ID | 1269 |
mRNA Refseq | NM_001841.3 |
Protein Refseq | NP_001832.1 |
MIM | 605051 |
UniProt ID | P34972 |
◆ Recombinant Proteins | ||
CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
CNR2-102HF | Recombinant Full Length Human CNR2 Protein | +Inquiry |
CNR2-26236TH | Recombinant Human CNR2 | +Inquiry |
RFL32311MF | Recombinant Full Length Mouse Cannabinoid Receptor 2(Cnr2) Protein, His-Tagged | +Inquiry |
RFL26956HF | Recombinant Full Length Human Cannabinoid Receptor 2(Cnr2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNR2 Products
Required fields are marked with *
My Review for All CNR2 Products
Required fields are marked with *
0
Inquiry Basket