"COMT" Related Products

Expand
Expand
Expand

Recombinant Human COMT

Cat.No.: COMT-27960TH
Product Overview: Recombinant fragment of Human COMT ; 221aa, 24.4 kDa.
Description: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters.
Protein length: 221 amino acids
Molecular Weight: 24.400kDa
Source: E. coli
Tissue specificity: Brain, liver, placenta, lymphocytes and erythrocytes.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.01% Magnesium chloride, 0.32% Tris HCl
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAM NVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLL SPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQ DIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLL RKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEY REVVDGLEKAIYKGPGSEAGP
Sequence Similarities: Belongs to the mammalian catechol-O-methyltransferase family.
Gene Name: COMT catechol-O-methyltransferase [ Homo sapiens ]
Official Symbol: COMT
Synonyms: COMT; catechol-O-methyltransferase; catechol O-methyltransferase;
Gene ID: 1312
mRNA Refseq: NM_000754
Protein Refseq: NP_000745
Uniprot ID: P21964
Chromosome Location: 22q11.21
Pathway: Biogenic Amine Synthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem;
Function: O-methyltransferase activity; catechol O-methyltransferase activity; magnesium ion binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.