Recombinant Human COMT

• Cat.No.: COMT-27960TH
• Product Overview: Recombinant fragment of Human COMT ; 221aa, 24.4 kDa.

Specification

• Description: Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters.
• Protein length: 221 amino acids
• Molecular Weight: 24.400kDa
• Source: E. coli
• Tissue specificity: Brain, liver, placenta, lymphocytes and erythrocytes.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.01% Magnesium chloride, 0.32% Tris HCl
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAM NVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLL SPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQ DIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLL RKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEY REVVDGLEKAIYKGPGSEAGP
• Sequence Similarities: Belongs to the mammalian catechol-O-methyltransferase family.

Gene Information

• Gene Name: COMT catechol-O-methyltransferase [ Homo sapiens ]
• Official Symbol: COMT
• Synonyms: COMT; catechol-O-methyltransferase; catechol O-methyltransferase
• Gene ID: 1312
• mRNA Refseq: NM_000754
• Protein Refseq: NP_000745
• Uniprot ID: P21964
• Chromosome Location: 22q11.21
• Pathway: Biogenic Amine Synthesis, organism-specific biosystem; Biological oxidations, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem
• Function: O-methyltransferase activity; catechol O-methyltransferase activity; magnesium ion binding; transferase activity