Recombinant Human COX4NB, His-tagged
Cat.No. : | COX4NB-26363TH |
Product Overview : | Recombinant full length Human COX4NB with an N terminal His tag; 230aa, 25.9kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 210 amino acids |
Description : | Neighbor of COX4 (COX4NB) belongs to the UPF0172 (NOC4) family. It is expressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta. |
Conjugation : | HIS |
Molecular Weight : | 25.900kDa inclusive of tags |
Tissue specificity : | Expressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
Sequence Similarities : | Belongs to the UPF0172 (NOC4) family. |
Gene Name | COX4NB COX4 neighbor [ Homo sapiens ] |
Official Symbol | COX4NB |
Synonyms | COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B; |
Gene ID | 10328 |
mRNA Refseq | NM_001142288 |
Protein Refseq | NP_001135760 |
MIM | 604886 |
Uniprot ID | O43402 |
Chromosome Location | 16q24 |
◆ Recombinant Proteins | ||
COX4NB-1552R | Recombinant Rat COX4NB Protein | +Inquiry |
COX4NB-1209R | Recombinant Rat COX4NB Protein, His (Fc)-Avi-tagged | +Inquiry |
COX4NB-814R | Recombinant Rhesus Macaque COX4NB Protein, His (Fc)-Avi-tagged | +Inquiry |
COX4NB-3628H | Recombinant Human COX4NB, His-tagged | +Inquiry |
COX4NB-989R | Recombinant Rhesus monkey COX4NB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4NB-7333HCL | Recombinant Human COX4NB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4NB Products
Required fields are marked with *
My Review for All COX4NB Products
Required fields are marked with *