"COX6B1" Related Products

Expand
Expand

Recombinant Human COX6B1

Cat.No.: COX6B1-27556TH
Product Overview: Recombinant full length Human COX6B1 with N-terminal proprietary tag. Predicted MW 35.20kDa.
Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.
Protein length: 87 amino acids
Molecular Weight: 35.200kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Sequence Similarities: Belongs to the cytochrome c oxidase subunit 6B family.
Gene Name: COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ]
Official Symbol: COX6B1
Synonyms: COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG;
Gene ID: 1340
mRNA Refseq: NM_001863
Protein Refseq: NP_001854
MIM: 124089
Uniprot ID: P14854
Chromosome Location: 19q13.1
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem;
Function: cytochrome-c oxidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.