"CPM" Related Products

Expand
Expand

Recombinant Human CPM

Cat.No.: CPM-27799TH
Product Overview: Recombinant fragment of Human Carboxypeptidase M with N-terminal proprietary tag. Predicted MW 36.52kDa.
Description: The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYG
Sequence Similarities: Belongs to the peptidase M14 family.
Gene Name: CPM carboxypeptidase M [ Homo sapiens ]
Official Symbol: CPM
Synonyms: CPM; carboxypeptidase M;
Gene ID: 1368
mRNA Refseq: NM_001874
Protein Refseq: NP_001865
MIM: 114860
Uniprot ID: P14384
Chromosome Location: 12q15
Function: carboxypeptidase activity; metal ion binding; metallocarboxypeptidase activity; metallopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.