Recombinant Human CPNE1, His-tagged
Cat.No. : | CPNE1-26782TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 273-537 of Human CPNE1 with an N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSLHYLSPTG VNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGP TNFAPIINHVARFAAQAAHQGTASQYFMLLLLTDGAVT DVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGG PLHTRSGQAAARDIVQFVPYRRFQNAPREALAQTVLAE VPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA |
Gene Name : | CPNE1 copine I [ Homo sapiens ] |
Official Symbol : | CPNE1 |
Synonyms : | CPNE1; copine I; copine-1; CPN1; |
Gene ID : | 8904 |
mRNA Refseq : | NM_001198863 |
Protein Refseq : | NP_001185792 |
MIM : | 604205 |
Uniprot ID : | Q99829 |
Chromosome Location : | 20q11.22 |
Function : | calcium-dependent phospholipid binding; phosphatidylserine binding; transporter activity; |
Products Types
◆ Recombinant Protein | ||
Cpne1-2289M | Recombinant Mouse Cpne1 Protein, Myc/DDK-tagged | +Inquiry |
CPNE1-396H | Recombinant Human CPNE1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CPNE1-3319H | Recombinant Human CPNE1 Protein, MYC/DDK-tagged | +Inquiry |
CPNE1-831R | Recombinant Rhesus Macaque CPNE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPNE1-8646H | Recombinant Human CPNE1 protein(Met1-Ala537), SUMO-tagged | +Inquiry |
◆ Lysates | ||
CPNE1-001HCL | Recombinant Human CPNE1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket