Recombinant Human CPNE1, His-tagged CPNE1-26782TH

Recombinant Human CPNE1, His-tagged

PRODUCTS

Home / Products / Recombinant Human CPNE1, His-tagged

Recombinant Human CPNE1, His-tagged

CPNE1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CPNE1-26782TH
Product Overview : Recombinant fragment, corresponding to amino acids 273-537 of Human CPNE1 with an N terminal His tag; Predicted MWt 29 kDa.
Description : Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSLHYLSPTG VNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGP TNFAPIINHVARFAAQAAHQGTASQYFMLLLLTDGAVT DVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGG PLHTRSGQAAARDIVQFVPYRRFQNAPREALAQTVLAE VPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA
Gene Name : CPNE1 copine I [ Homo sapiens ]
Official Symbol : CPNE1
Synonyms : CPNE1; copine I; copine-1; CPN1;
Gene ID : 8904
mRNA Refseq : NM_001198863
Protein Refseq : NP_001185792
MIM : 604205
Uniprot ID : Q99829
Chromosome Location : 20q11.22
Function : calcium-dependent phospholipid binding; phosphatidylserine binding; transporter activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy