"CSDE1" Related Products

Expand
Expand
Expand

Recombinant Human CSDE1, His-tagged

Cat.No.: CSDE1-28019TH
Product Overview: Recombinant fragment, corresponding to amino acids 515-767 of Human CSDE1 Isoform 2 with N terminal His tag; Predicted MWt 29 kDa.
Description: RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 132 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSV NGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVE EGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQ NAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLF FHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVC EGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPR GPDNSMGFGAERKIRQAGVID
Gene Name: CSDE1 cold shock domain containing E1, RNA-binding [ Homo sapiens ]
Official Symbol: CSDE1
Synonyms: CSDE1; cold shock domain containing E1, RNA-binding; cold shock domain-containing protein E1; D1S155E; UNR; upstream of NRAS;
Gene ID: 7812
mRNA Refseq: NM_001130523
Protein Refseq: NP_001123995
MIM: 191510
Uniprot ID: O75534
Chromosome Location: 1p13.2
Pathway: Validated targets of C-MYC transcriptional repression, organism-specific biosystem;
Function: DNA binding; RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.