Description : |
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. |
Protein length : |
131 amino acids |
Conjugation : |
HIS |
Molecular Weight : |
17.200kDa inclusive of tags |
Source : |
E. coli |
Tissue specificity : |
Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas. Not expressed in brain. Barely expressed in tumor cell lines except for breast adenocarcinoma MCF-7 cells and U251 cells. |
Form : |
Liquid |
Purity : |
>90% by SDS-PAGE |
Storage buffer : |
pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea, 10% Glycerol |
Storage : |
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : |
MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMF LATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRK WRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVR QGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
Sequence Similarities : |
Belongs to the cystatin family. |