Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
29-159 a.a. |
Description : |
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq, Jul 2008] |
Form : |
Liquid |
Molecular Mass : |
17.2 kDa |
AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK |
Purity : |
> 90% by SDS-PAGE |
Applications : |
SDS-PAGE |
Storage : |
Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : |
1 mg/mL |
Storage Buffer : |
In 20 mM Tris-HCl. pH 8.0. (10% glycerol, 0.4 M urea) |