Recombinant Human CST9 Protein, His-tagged

Cat.No. : CST9-2035H
Product Overview : Human CST9 (NP_001008693, 29 a.a. - 159 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 29-159 a.a.
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq, Jul 2008]
Form : Liquid
Molecular Mass : 17.2 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris-HCl. pH 8.0. (10% glycerol, 0.4 M urea)
Gene Name CST9 cystatin 9 (testatin) [ Homo sapiens ]
Official Symbol CST9
Synonyms CST9; cystatin 9 (testatin); cystatin-9; CLM; cystatin-like molecule;
Gene ID 128822
mRNA Refseq NM_001008693
Protein Refseq NP_001008693
MIM 616543
UniProt ID Q5W186

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST9 Products

Required fields are marked with *

My Review for All CST9 Products

Required fields are marked with *

0
cart-icon