Recombinant Human CST9, His-tagged

Cat.No. : CST9-26433TH
Product Overview : Recombinant full length Human CST9 with N terminal His tag; 152 amino acids with tag, Predicted MWt 17.2 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 131 amino acids
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation.
Conjugation : HIS
Molecular Weight : 17.200kDa inclusive of tags
Tissue specificity : Expressed in heart, placenta, lung, liver, skeletal muscle and pancreas. Not expressed in brain. Barely expressed in tumor cell lines except for breast adenocarcinoma MCF-7 cells and U251 cells.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea, 10% Glycerol
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMF LATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRK WRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVR QGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Sequence Similarities : Belongs to the cystatin family.
Gene Name CST9 cystatin 9 (testatin) [ Homo sapiens ]
Official Symbol CST9
Synonyms CST9; cystatin 9 (testatin); cystatin-9; CLM;
Gene ID 128822
mRNA Refseq NM_001008693
Protein Refseq NP_001008693
Uniprot ID Q5W186
Chromosome Location 20p11.21
Function cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST9 Products

Required fields are marked with *

My Review for All CST9 Products

Required fields are marked with *

0
cart-icon
0
compare icon