"CTBP2" Related Products

Expand
Expand

Recombinant Human CTBP2

Cat.No.: CTBP2-28021TH
Product Overview: Recombinant full length Human CTBP2 with N terminal proprietary tag; Predicted MWt 75.06 kDa.
Description: This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3 untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10.
Protein length: 445 amino acids
Molecular Weight: 75.060kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLD GRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAM MYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGT RVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTP HTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNRE HPNEQ
Sequence Similarities: Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
Gene Name: CTBP2 C-terminal binding protein 2 [ Homo sapiens ]
Official Symbol: CTBP2
Synonyms: CTBP2; C-terminal binding protein 2; C-terminal-binding protein 2; ribeye;
Gene ID: 1488
mRNA Refseq: NM_001329
Protein Refseq: NP_001320
MIM: 602619
Uniprot ID: P56545
Chromosome Location: 10q26.13
Pathway: Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function: NAD binding; cofactor binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.