Recombinant Human CTBP2 CTBP2-28021TH

Recombinant Human CTBP2

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CTBP2

Recombinant Human CTBP2

CTBP2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CTBP2-28021TH
Product Overview : Recombinant full length Human CTBP2 with N terminal proprietary tag; Predicted MWt 75.06 kDa.
Description : This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3 untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10.
Protein length : 445 amino acids
Molecular Weight : 75.060kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLD GRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAM MYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGT RVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTP HTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNRE HPNEQ
Sequence Similarities : Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
Gene Name : CTBP2 C-terminal binding protein 2 [ Homo sapiens ]
Official Symbol : CTBP2
Synonyms : CTBP2; C-terminal binding protein 2; C-terminal-binding protein 2; ribeye;
Gene ID : 1488
mRNA Refseq : NM_001329
Protein Refseq : NP_001320
MIM : 602619
Uniprot ID : P56545
Chromosome Location : 10q26.13
Pathway : Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function : NAD binding; cofactor binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy