"CTTN" Related Products

Expand
Expand
Expand

Recombinant Human CTTN, His-tagged

Cat.No.: CTTN-27962TH
Product Overview: Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa.
Description: This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 38 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR
Sequence Similarities: Contains 7 cortactin repeats.Contains 1 SH3 domain.
Gene Name: CTTN cortactin [ Homo sapiens ]
Official Symbol: CTTN
Synonyms: CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin;
Gene ID: 2017
mRNA Refseq: NM_001184740
Protein Refseq: NP_001171669
MIM: 164765
Uniprot ID: Q14247
Chromosome Location: 11q13
Pathway: Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.