Recombinant Human CTTN, His-tagged

• Cat.No.: CTTN-27962TH
• Product Overview: Recombinant fragment, corresponding to amino acids 503-593 of Human Cortactin, isoform CRA_a with N terminal His tag; Predicted MWt 10 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 503-593 a.a.
• Description: This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 38 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKDCP RRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWE ICLCHTVTARRIR
• Sequence Similarities: Contains 7 cortactin repeats.Contains 1 SH3 domain.

Gene Information

• Gene Name: CTTN cortactin [ Homo sapiens ]
• Official Symbol: CTTN
• Synonyms: CTTN; cortactin; EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma associated (p80/85 src substrate); src substrate cortactin
• Gene ID: 2017
• mRNA Refseq: NM_001184740
• Protein Refseq: NP_001171669
• MIM: 164765
• Uniprot ID: Q14247
• Chromosome Location: 11q13
• Pathway: Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; N-cadherin signaling events, organism-specific biosystem
• Function: protein binding