"CUTC" Related Products

Expand
Expand
Expand

Recombinant Human CUTC, His-tagged

Cat.No.: CUTC-26654TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-273 of Human CUTC with N terminal His tag, Predicted MWt 30 kDa.
Description: Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 81 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVN AERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPV FVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVF GALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDP MAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKG RIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSG MKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKN ILV
Sequence Similarities: Belongs to the CutC family.
Gene Name: CUTC cutC copper transporter homolog (E. coli) [ Homo sapiens ]
Official Symbol: CUTC
Synonyms: CUTC; cutC copper transporter homolog (E. coli); copper homeostasis protein cutC homolog; CGI 32;
Gene ID: 51076
mRNA Refseq: NM_015960
Protein Refseq: NP_057044
MIM: 610101
Uniprot ID: Q9NTM9
Chromosome Location: 10q24.31
Function: copper ion binding; copper ion binding; copper ion binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.