Recombinant Human CUTC, His-tagged CUTC-26654TH

Recombinant Human CUTC, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CUTC, His-tagged

Recombinant Human CUTC, His-tagged

CUTC Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CUTC-26654TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-273 of Human CUTC with N terminal His tag, Predicted MWt 30 kDa.
Description : Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 81 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVN AERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPV FVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVF GALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDP MAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKG RIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSG MKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKN ILV
Sequence Similarities : Belongs to the CutC family.
Gene Name : CUTC cutC copper transporter homolog (E. coli) [ Homo sapiens ]
Official Symbol : CUTC
Synonyms : CUTC; cutC copper transporter homolog (E. coli); copper homeostasis protein cutC homolog; CGI 32;
Gene ID : 51076
mRNA Refseq : NM_015960
Protein Refseq : NP_057044
MIM : 610101
Uniprot ID : Q9NTM9
Chromosome Location : 10q24.31
Function : copper ion binding; copper ion binding; copper ion binding; metal ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy