Recombinant Human CUTC, His-tagged
Cat.No. : | CUTC-26654TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-273 of Human CUTC with N terminal His tag, Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 81 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVN AERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPV FVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVF GALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDP MAALETLLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKG RIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSG MKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKN ILV |
Sequence Similarities : | Belongs to the CutC family. |
Gene Name : | CUTC cutC copper transporter homolog (E. coli) [ Homo sapiens ] |
Official Symbol : | CUTC |
Synonyms : | CUTC; cutC copper transporter homolog (E. coli); copper homeostasis protein cutC homolog; CGI 32; |
Gene ID : | 51076 |
mRNA Refseq : | NM_015960 |
Protein Refseq : | NP_057044 |
MIM : | 610101 |
Uniprot ID : | Q9NTM9 |
Chromosome Location : | 10q24.31 |
Function : | copper ion binding; copper ion binding; copper ion binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
CUTC-4083M | Recombinant Mouse Cutc Protein, MYC/DDK-tagged | +Inquiry |
CUTC-2138H | Recombinant Human CUTC Protein, GST-tagged | +Inquiry |
Cutc-2381M | Recombinant Mouse Cutc Protein, Myc/DDK-tagged | +Inquiry |
CUTC-3383H | Recombinant Human CUTC Protein, MYC/DDK-tagged | +Inquiry |
CUTC-1642C | Recombinant Chicken CUTC | +Inquiry |
◆ Lysates | ||
CUTC-423HCL | Recombinant Human CUTC cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CUTC Products
Required fields are marked with *
My Review for All CUTC Products
Required fields are marked with *
0
Inquiry Basket