Recombinant Human CXXC1, His-tagged
Cat.No. : | CXXC1-27242TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 250-632 of Human CGBP with an N terminal His tag. Predicted mwt: 46 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Description : | Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 92 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KLGRIREDEGAVASSTVKEPPEATATPEPLSDEDLPLDPD LYQDFCAGAFDDHGLPWMSDTEESPFLDPALRKRAVKV KHVKRREKKSEKKKEERYKRHRQKQKHKDKWKHPERAD AKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIY EILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTR LQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDTD LQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPT RIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVP ADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLR RAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGL |
Gene Name : | CXXC1 CXXC finger protein 1 [ Homo sapiens ] |
Official Symbol : | CXXC1 |
Synonyms : | CXXC1; CXXC finger protein 1; CXXC finger 1 (PHD domain); cpG-binding protein; CFP1; CGBP; CpG binding protein; DNA binding protein with PHD finger and CXXC domain; hCGBP; HsT2645; PCCX1; PHF18; SPP1; ZCGPC1; zinc finger; CpG binding type containing 1; |
Gene ID : | 30827 |
mRNA Refseq : | NM_001101654 |
Protein Refseq : | NP_001095124 |
MIM : | 609150 |
Uniprot ID : | Q9P0U4 |
Chromosome Location : | 18q12 |
Pathway : | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Unfolded Protein Response, organism-specific biosystem; |
Function : | DNA binding; contributes_to histone methyltransferase activity (H3-K4 specific); metal ion binding; protein binding; unmethylated CpG binding; |
Products Types
◆ Recombinant Protein | ||
CXXC1-943R | Recombinant Rhesus Macaque CXXC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXXC1-2204H | Recombinant Human CXXC1 Protein, GST-tagged | +Inquiry |
CXXC1-1118R | Recombinant Rhesus monkey CXXC1 Protein, His-tagged | +Inquiry |
CXXC1-3305H | Recombinant Human CXXC1 protein, His-tagged | +Inquiry |
◆ Lysates | ||
CXXC1-7151HCL | Recombinant Human CXXC1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CXXC1 Products
Required fields are marked with *
My Review for All CXXC1 Products
Required fields are marked with *
0
Inquiry Basket