"CYP1B1" Related Products

Expand
Expand
Expand

Recombinant Human CYP1B1 protein, GST-tagged

Cat.No.: CYP1B1-28190TH
Product Overview: Recombinant Human CYP1B1(NP_000095, 453 a.a. - 542 a.a.) protein fused with GST-tag at N-terminal was expressed in wheat germ.
Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 35.64 kDa
AA Sequence: NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
Applications: AP; Array; ELISA; WB-Re
Notes: Aliquot to avoid repeated freezing and thawing. Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade.
Gene Name: Cytochrome P450 family 1 subfamily B member 1 [Homo sapiens (human)]
Official Symbol: CYP1B1
Synonyms: CP1B; ASGD6; GLC3A; CYPIB1; P4501B1
Gene ID: 1545
mRNA Refseq: NM_000104.3
Protein Refseq: NP_000095.2
MIM: 601771
UniProt ID: Q16678

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.