Recombinant Human DBN1, His-tagged

• Cat.No.: DBN1-28133TH
• Product Overview: Recombinant fragment, corresponding to amino acids 289-467 of Human Drebrin with N terminal His tag; 179 amino acids, 20.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 289-467 a.a.
• Description: The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of this protein in the brain has been implicated as a possible contributing factor in the pathogenesis of memory disturbance in Alzheimers disease. At least two alternative splice variants encoding different protein isoforms have been described for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 134 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: NPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRM APTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPP LPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADAT EIHDAADTIETDTATADTTVANN

Gene Information

• Gene Name: DBN1 drebrin 1 [ Homo sapiens ]
• Official Symbol: DBN1
• Synonyms: DBN1; drebrin 1; D0S117E; drebrin
• Gene ID: 1627
• mRNA Refseq: NM_004395
• Protein Refseq: NP_004386
• MIM: 126660
• Uniprot ID: Q16643
• Chromosome Location: 5q35.3
• Function: actin binding; profilin binding