"DBN1" Related Products

Expand
Expand

Recombinant Human DBN1, His-tagged

Cat.No.: DBN1-28133TH
Product Overview: Recombinant fragment, corresponding to amino acids 289-467 of Human Drebrin with N terminal His tag; 179 amino acids, 20.6kDa.
Description: The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of this protein in the brain has been implicated as a possible contributing factor in the pathogenesis of memory disturbance in Alzheimers disease. At least two alternative splice variants encoding different protein isoforms have been described for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 134 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: NPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRM APTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPP LPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAEDLMFMESAEQAVLAAPVEPATADAT EIHDAADTIETDTATADTTVANN
Gene Name: DBN1 drebrin 1 [ Homo sapiens ]
Official Symbol: DBN1
Synonyms: DBN1; drebrin 1; D0S117E; drebrin;
Gene ID: 1627
mRNA Refseq: NM_004395
Protein Refseq: NP_004386
MIM: 126660
Uniprot ID: Q16643
Chromosome Location: 5q35.3
Function: actin binding; profilin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.