Recombinant Human DCAF6, His-tagged DCAF6-27575TH

Recombinant Human DCAF6, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DCAF6, His-tagged

Recombinant Human DCAF6, His-tagged

DCAF6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DCAF6-27575TH
Product Overview : Recombinant fragment, corresponding to amino acids 536-860 of Human NRIP with N terminal His tag; 325 amino acids, 74kDa.
Description : WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 68 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ETKAPEESSEDVTKYQEGVSAENPVENHINITQSDKFTAK PLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQ TSTESATNENNTNPEPQFQTEATGPSAHEETSTRDSAL QDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRK ERKEMEELDTLNIRRPLVKMVYKGHRNSRTMIKEANFW GANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCL QPHPFDPILASSGIDYDIKIWSPLEESRIFNRKLADEVIT RNELMLEETRNTITVPASFMLRMLASLNHIRADRLEGD RSEGSGQENENEDEE
Gene Name : DCAF6 DDB1 and CUL4 associated factor 6 [ Homo sapiens ]
Official Symbol : DCAF6
Synonyms : DCAF6; DDB1 and CUL4 associated factor 6; IQ motif and WD repeats 1 , IQWD1; DDB1- and CUL4-associated factor 6; PC326;
Gene ID : 55827
mRNA Refseq : NM_018442
Protein Refseq : NP_060912
MIM : 610494
Uniprot ID : Q58WW2
Chromosome Location : 1q23.3
Function : ligand-dependent nuclear receptor transcription coactivator activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy