Recombinant Human DCAF6 protein, GST-tagged
| Cat.No. : | DCAF6-5762H |
| Product Overview : | Recombinant Human DCAF6 protein(1-232 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-232 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | RERDGEQSPNVSLMQRMSDMLSRWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSETAMEVDTPAEQFLQPSTSSTMSAQAHSTSSPTESPHSTPLLSSPDSEQRQSVEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTDEWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDATKYQEGVSAENPV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | DCAF6 |
| Synonyms | DCAF6; DDB1 and CUL4 associated factor 6; IQ motif and WD repeats 1 , IQWD1; DDB1- and CUL4-associated factor 6; PC326 |
| Gene ID | 55827 |
| mRNA Refseq | NM_018442 |
| Protein Refseq | NP_060912 |
| MIM | 610494 |
| UniProt ID | Q58WW2 |
| ◆ Recombinant Proteins | ||
| DCAF6-27575TH | Recombinant Human DCAF6, His-tagged | +Inquiry |
| DCAF6-5763H | Recombinant Human DCAF6 protein, His-tagged | +Inquiry |
| DCAF6-5723HF | Recombinant Full Length Human DCAF6 Protein, GST-tagged | +Inquiry |
| DCAF6-4338M | Recombinant Mouse DCAF6 Protein | +Inquiry |
| DCAF6-5057H | Recombinant Human DCAF6 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCAF6-870HCL | Recombinant Human DCAF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCAF6 Products
Required fields are marked with *
My Review for All DCAF6 Products
Required fields are marked with *
