Recombinant Human DCTN2, His-tagged DCTN2-26061TH

Recombinant Human DCTN2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DCTN2, His-tagged

Recombinant Human DCTN2, His-tagged

DCTN2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DCTN2-26061TH
Product Overview : Recombinant fragment, corresponding to amino acids 132-406 of Human Dynamitin with N terminas His tag, 275aa, 35kDa,
Description : This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:reconstitution with 52 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINL TDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSL VTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQ DAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR LQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWS PIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQ MIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM KKLGK
Gene Name : DCTN2 dynactin 2 (p50) [ Homo sapiens ]
Official Symbol : DCTN2
Synonyms : DCTN2; dynactin 2 (p50); dynactin subunit 2; DCTN 50; RBP50;
Gene ID : 10540
mRNA Refseq : NM_006400
Protein Refseq : NP_006391
MIM : 607376
Uniprot ID : Q13561
Chromosome Location : 12q13.3
Pathway : Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function : motor activity; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy