Recombinant Human DCTN2, His-tagged
Cat.No. : | DCTN2-26061TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 132-406 of Human Dynamitin with N terminas His tag, 275aa, 35kDa, |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 52 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINL TDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSL VTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQ DAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEAR LQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWS PIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQ MIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERM KKLGK |
Gene Name : | DCTN2 dynactin 2 (p50) [ Homo sapiens ] |
Official Symbol : | DCTN2 |
Synonyms : | DCTN2; dynactin 2 (p50); dynactin subunit 2; DCTN 50; RBP50; |
Gene ID : | 10540 |
mRNA Refseq : | NM_006400 |
Protein Refseq : | NP_006391 |
MIM : | 607376 |
Uniprot ID : | Q13561 |
Chromosome Location : | 12q13.3 |
Pathway : | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function : | motor activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DCTN2-729H | Recombinant Human DCTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTN2-2411H | Recombinant Human DCTN2 Protein, GST-tagged | +Inquiry |
DCTN2-1459R | Recombinant Rat DCTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dctn2-2481M | Recombinant Mouse Dctn2 Protein, Myc/DDK-tagged | +Inquiry |
DCTN2-1801R | Recombinant Rat DCTN2 Protein | +Inquiry |
◆ Lysates | ||
DCTN2-7042HCL | Recombinant Human DCTN2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DCTN2 Products
Required fields are marked with *
My Review for All DCTN2 Products
Required fields are marked with *
0
Inquiry Basket