"DDAH2" Related Products

Expand
Expand

Recombinant Human DDAH2, His-tagged

Cat.No.: DDAH2-26260TH
Product Overview: Recombinant fragment, corresponding to amino acids 71-261 of Human DDAH2 with N terminal His tag; MWt 22kDa.
Description: This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
Conjugation: HIS
Source: E. coli
Tissue specificity: Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain.
Form: Lyophilised:Reconstitute with 53 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDL GLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRG AEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVA GSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR PGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVS
Sequence Similarities: Belongs to the DDAH family.
Gene Name: DDAH2 dimethylarginine dimethylaminohydrolase 2 [ Homo sapiens ]
Official Symbol: DDAH2
Synonyms: DDAH2; dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2;
Gene ID: 23564
mRNA Refseq: NM_013974
Protein Refseq: NP_039268
MIM: 604744
Uniprot ID: O95865
Chromosome Location: 6p21
Function: amino acid binding; catalytic activity; dimethylargininase activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.