"DECR1" Related Products

Expand
Expand

Recombinant Human DECR1, His-tagged

Cat.No.: DECR1-26259TH
Product Overview: Recombinant full length Human DECR1 with N terminal His tag; 322 amino acids with tag, MWt 34.4 kDa.
Description: This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters.
Protein length: 301 amino acids
Conjugation: HIS
Molecular Weight: 34.400kDa inclusive of tags
Source: E. coli
Tissue specificity: Heart = liver = pancreas >kidney >>skeletal muscle = lung.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHM NTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
Gene Name: DECR1 2,4-dienoyl CoA reductase 1, mitochondrial [ Homo sapiens ]
Official Symbol: DECR1
Synonyms: DECR1; 2,4-dienoyl CoA reductase 1, mitochondrial; DECR; 2,4-dienoyl-CoA reductase, mitochondrial; SDR18C1; short chain dehydrogenase/reductase family 18C; member 1;
Gene ID: 1666
mRNA Refseq: NM_001359
Protein Refseq: NP_001350
Uniprot ID: Q16698
Chromosome Location: 8q21.3
Pathway: Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Mitochondrial Fatty Acid Beta-Oxidation, organism-specific biosystem;
Function: 2,4-dienoyl-CoA reductase (NADPH) activity; 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotide binding; oxidoreductase activity, acting on NADH or NADPH;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.