Recombinant Human DECR1, GST-tagged
| Cat.No. : | DECR1-973H |
| Product Overview : | Recombinant human DECR1 with gst tag atN-terminal was produced in wheat germ expressionsystem in vitro and purified by Glutathione Sepharose 4 Fast Flow, 36.74 kDa(236 a.a. - 335 a.a.). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 236-335 a.a. |
| Description : | This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters. |
| Amino Acid Sequence : | NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS |
| Note : | Best use within three months from the date ofreceipt of this protein. |
| Applications : | ELISA;WB; Antibody Production; Protein Array |
| StorageBuffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Storage : | Store at-80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | DECR1 |
| Gene Name | DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens] |
| Synonyms | DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH] |
| Gene ID | 1666 |
| mRNA Refseq | NM_001359 |
| Protein Refseq | NP_001350 |
| MIM | 222745 |
| UniProt ID | Q16698 |
| Chromosome Location | 8q21.3 |
| Pathway | Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid |
| Function | 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding |
| ◆ Recombinant Proteins | ||
| DECR1-576Z | Recombinant Zebrafish DECR1 | +Inquiry |
| Decr1-2516M | Recombinant Mouse Decr1 Protein, Myc/DDK-tagged | +Inquiry |
| DECR1-26H | Recombinant Human DECR1 protein, MYC/DDK-tagged | +Inquiry |
| DECR1-973H | Recombinant Human DECR1, GST-tagged | +Inquiry |
| DECR1-971H | Recombinant Human 2,4-Dienoyl-CoA Reductase, Mitochondrial, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DECR1-6997HCL | Recombinant Human DECR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DECR1 Products
Required fields are marked with *
My Review for All DECR1 Products
Required fields are marked with *
