Recombinant Human DECR1, GST-tagged

Cat.No. : DECR1-973H
Product Overview : Recombinant human DECR1 with gst tag atN-terminal was produced in wheat germ expressionsystem in vitro and purified by Glutathione Sepharose 4 Fast Flow, 36.74 kDa(236 a.a. - 335 a.a.).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 236-335 a.a.
Description : This geneencodes an accessory enzyme which participates in the beta-oxidation andmetabolism of unsaturated fatty enoyl-CoA esters.
Amino Acid Sequence : NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
Note : Best use within three months from the date ofreceipt of this protein.
Applications : ELISA;WB; Antibody Production; Protein Array
StorageBuffer : 50 mMTris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Storage : Store at-80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : DECR1
Gene Name DECR1 2,4-dienoyl CoA reductase1, mitochondrial [Homo sapiens]
Synonyms DECR1; DECR; NADPH;SDR18C1; 2,4-dienoyl CoA reductase 1, mitochondrial; 2,4-dienoyl-CoAreductase, mitochondrial;4-enoyl-CoA reductase;short chaindehydrogenase/reductase family 18C, member 1; 4-enoyl-CoA reductase [NADPH];EC1.3.1.34; 2,4-dienoyl-CoA reductase [NADPH]
Gene ID 1666
mRNA Refseq NM_001359
Protein Refseq NP_001350
MIM 222745
UniProt ID Q16698
Chromosome Location 8q21.3
Pathway Fatty Acid BetaOxidation; Fatty Acid Biosynthesis; Fatty acid
Function 2,4-dienoyl-CoA reductase (NADPH) activity; NADPH binding; nucleotidebinding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DECR1 Products

Required fields are marked with *

My Review for All DECR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon