"DEFB4A" Related Products

Expand
Expand

Recombinant Human DEFB4A

Cat.No.: DEFB4A-27476TH
Product Overview: Recombinant full length Human BD2 ; 41 amino acids with a predicted MWt 4.3kDa.
Description: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.
Protein length: 41 amino acids
Molecular Weight: 4.300kDa
Source: E. coli
Biological activity: Determined by the ability to chemoattract Human dendritic immature cells at a concentration of 10,000-100,000ng/ml corresponding to a specific activity of 10-100IU/mg.
Form: Lyophilised:It is recommended to reconstitute in sterile ultra pure water not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Purity: >95% by SDS-PAGE
Storage buffer: pH: 7.40Constituents:0.48% PBS, 0.76% Sodium chloride
Storage: Please see Notes section
Sequences of amino acids: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Gene Name: DEFB4A defensin, beta 4A [ Homo sapiens ]
Official Symbol: DEFB4A
Synonyms: DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1;
Gene ID: 1673
mRNA Refseq: NM_004942
Protein Refseq: NP_004933
MIM: 602215
Uniprot ID: O15263
Chromosome Location: 8p23.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.