"DEFB4A" Related Products

Expand
Expand

Recombinant Human DEFB4A protein

Cat.No. : DEFB4A-27476TH
Product Overview : Recombinant Human DEFB4A protein was expressed in Escherichia coli.
Description : Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Four human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 4.3 kDa, a single non-glycosylated polypeptide chain containing 41 amino acids.
Protein length : 41
AA Sequence : GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Endotoxin : Less than 1 EU/µg of rHuBD-2 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
SDS-PAGE of DEFB4A-27476TH :

Gene Name : DEFB4A
Official Symbol : DEFB4A
Synonyms : DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1; BD-2; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102;
Gene ID : 1673
mRNA Refseq : NM_004942
Protein Refseq : NP_004933
MIM : 602215
UniProt ID : O15263

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.