Recombinant Human DEFB4A protein
Cat.No. : | DEFB4A-27476TH |
Product Overview : | Recombinant Human DEFB4A protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
Description : | Defensins (alpha and beta) are cationic peptides with antimicrobial activity against Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses. They are 2-6 kDa proteins and take important roles in innate immune system. On the basis of their size and pattern of disulfide bonding, mammalian defensins are classified into alpha, beta and theta categories. β-Defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Four human β-defensins have been identified and they are expressed on some leukocytes and at epithelial surfaces. Because β-defensins is cationic peptides, they can therefore interact with the membrane of invading microbes, which are negative due to lipopolysaccharides (LPS) and lipoteichoic acid (LTA) found in the cell membrane. Especially, they have higher affinity to the binding site compared to Ca2+ and Mg2+ ions. Furthermore, they can affect the stability of the membrane. |
Source : | E.coli |
Species : | Human |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 4.3 kDa, a single non-glycosylated polypeptide chain containing 41 amino acids. |
Protein length : | 41 |
AA Sequence : | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
Endotoxin : | Less than 1 EU/µg of rHuBD-2 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name : | DEFB4A |
Official Symbol : | DEFB4A |
Synonyms : | DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1; BD-2; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; |
Gene ID : | 1673 |
mRNA Refseq : | NM_004942 |
Protein Refseq : | NP_004933 |
MIM : | 602215 |
UniProt ID : | O15263 |
Products Types
◆ Recombinant Protein | ||
DEFB4A-133D | Active Recombinant Human DEFB4A Protein (50 aa) | +Inquiry |
DEFB4A-1333H | Recombinant Human DEFB4A Protein, His-tagged | +Inquiry |
DEFB4A-5133H | Recombinant Human DEFB4A Protein, GST-tagged | +Inquiry |
DEFB4A-1064R | Recombinant Rhesus Macaque DEFB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB4A -5387H | Recombinant Human Defensin, Beta 4A | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionDEFB4A has a typical β-defensin structure consisting of a cysteine-rich mature peptide region and a positively charged N-terminal region. This structure allows it to bind and destroy the cell membranes of pathogenic microorganisms.
Biomolecules that can be used as molecular markers for DEFB4A include its mRNA and protein expression products in tissues and cells, as well as other biomolecules (e.g., receptors, signal transduction molecules, etc.) that interact with it.
The abnormal expression of DEFB4A is associated with a variety of inflammatory and infectious diseases, such as psoriasis, atopic dermatitis, chronic sinusitis, etc. In addition, the expression of DEFB4A has also been found to be associated with the occurrence and progression of certain tumors.
Therapeutic strategies for DEFB4A include modulating its expression levels, enhancing its antimicrobial activity, and developing inhibitors targeting its signaling pathway. Treatment depends on the type and severity of the disease.
The mRNA and protein expression levels of DEFB4A in tissues and cells can be detected by real-time PCR, immunohistochemistry, and western blotting.
There are interactions between DEFB4A and other biomolecules. For example, it can bind to the cell membrane of pathogenic microorganisms and disrupt their integrity to exert antimicrobial effects, and it can also bind to receptors on the surface of epithelial cells to activate signal transduction pathways and regulate cellular immune responses.
Customer Reviews (3)
Write a reviewThe structure is very stable and not easy to deteriorate.
The cost is low and the activity is strong, which greatly saves our scientific research costs.
The quality of the DEFB4A is very high, which makes my experiments more smooth and accurate.
Ask a Question for All DEFB4A Products
Required fields are marked with *
My Review for All DEFB4A Products
Required fields are marked with *
Inquiry Basket