"DEFB4A" Related Products

Expand
Expand

Recombinant Human DEFB4A Protein, GST-tagged

Cat.No. : DEFB4A-5133H
Product Overview : Human DEFB4 full-length ORF ( NP_004933.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 33.4 kDa
AA Sequence : MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : DEFB4A defensin beta 4A [ Homo sapiens (human) ]
Official Symbol : DEFB4A
Synonyms : DEFB4; DEFB4A; defensin beta 4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; beta-defensin 4A; beta defensin-2; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1
Gene ID : 1673
mRNA Refseq : NM_004942
Protein Refseq : NP_004933
MIM : 602215
UniProt ID : O15263

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.