"DGKZ" Related Products

Expand
Expand
Expand

Recombinant Human DGKZ, His-tagged

Cat.No.: DGKZ-26682TH
Product Overview: Recombinant fragment, corresponding to amino acids 641-895 of Human DGKZ with N terminal His tag; MWt 35kDa.
Description: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highest levels in brain, and substantial levels in skeletal muscle, heart, and pancreas. Isoform 1 is predominantly expressed in muscle.
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSP KWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILD PELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPP QGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLL HHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTE LAAYLENRQHYQMIQREDQETAV
Sequence Similarities: Belongs to the eukaryotic diacylglycerol kinase family.Contains 2 ANK repeats.Contains 1 DAGKc domain.Contains 2 phorbol-ester/DAG-type zinc fingers.
Gene Name: DGKZ diacylglycerol kinase, zeta [ Homo sapiens ]
Official Symbol: DGKZ
Synonyms: DGKZ; diacylglycerol kinase, zeta; diacylglycerol kinase, zeta 104kDa; diacylglycerol kinase zeta; DAGK5; DAGK6; DGK ZETA; hDGKzeta;
Gene ID: 8525
mRNA Refseq: NM_001199267
Protein Refseq: NP_001186196
MIM: 601441
Uniprot ID: Q13574
Chromosome Location: 11p11.2
Pathway: Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem;
Function: ATP binding; diacylglycerol kinase activity; diacylglycerol kinase activity; enzyme inhibitor activity; lipid kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.