"DHX8" Related Products

Recombinant Human DHX8

Cat.No.: DHX8-27450TH
Product Overview: Recombinant fragment of Human DHX8 with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Sequence Similarities: Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 S1 motif domain.
Gene Name: DHX8 DEAH (Asp-Glu-Ala-His) box polypeptide 8 [ Homo sapiens ]
Official Symbol: DHX8
Synonyms: DHX8; DEAH (Asp-Glu-Ala-His) box polypeptide 8; DDX8, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase); ATP-dependent RNA helicase DHX8; HRH1; PRP22; PRPF22;
Gene ID: 1659
mRNA Refseq: NM_004941
Protein Refseq: NP_004932
MIM: 600396
Uniprot ID: Q14562
Chromosome Location: 17q21.31
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; mRNA processing, organism-specific biosystem;
Function: ATP binding; ATP-dependent RNA helicase activity; RNA binding; helicase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.