Recombinant Human DIRAS1, His-tagged

• Cat.No.: DIRAS1-28349TH
• Product Overview: Recombinant full length Human DIRAS1 with an N terminal His tag; 215 amino acids with tag, Predicted MWt 24.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 195 amino acids
• Description: DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.
• Conjugation: HIS
• Molecular Weight: 24.100kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC

Gene Information

• Gene Name: DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ]
• Official Symbol: DIRAS1
• Synonyms: DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG
• Gene ID: 148252
• mRNA Refseq: NM_145173
• Protein Refseq: NP_660156
• MIM: 607862
• Uniprot ID: O95057
• Chromosome Location: 19p13.3
• Function: GTP binding; GTPase activity; nucleotide binding